Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZP3 Rabbit Polyclonal Antibody (Biotin)

ZP3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZPC, ZP3A, ZP3B, Zp-3, OOMD3

UniProt

P21754

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZP3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NKGDCGTPSHSRRQPHVMSQWSRSASRNRRHVTEEADVTVGATDLPGQEW

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/3284), 0.2mg/mL
BNUB3284-500 1x 500 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/3284), 0.2mg/mL

Sign In for Pricing
View Details
CD45RB (PTPRC/1147), CF594 conjugate, 0.1mg/mL
BNC941147-100 1x 100 µL

CD45RB (PTPRC/1147), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human LMIR2/CD300C Protein (His Tag)
PKSH032701-01 10 µg

Recombinant Human LMIR2/CD300C Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human LMIR2/CD300C Protein (His Tag)
PKSH032701-02 50 µg

Recombinant Human LMIR2/CD300C Protein (His Tag)

Sign In for Pricing
View Details
Catalase (CAT) Activity Assay Kit
E-BC-K031-S-01 50 Assays (25 samples)

Catalase (CAT) Activity Assay Kit

Sign In for Pricing
View Details
Catalase (CAT) Activity Assay Kit
E-BC-K031-S-02 100 Assays (50 samples)

Catalase (CAT) Activity Assay Kit

Sign In for Pricing
View Details