Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUFIP1 Rabbit Polyclonal Antibody (HRP)

NUFIP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Rsa1, NUFIP, bA540M5.1

UniProt

Q9UHK0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NUFIP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GQPWNFHASTSWYWRQSSDRFPRHQKSFNPAVKNSYYPRKYDAKFTDFSL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_036477

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human EDARADD activation kit by CRISPRa
GA115025 1 Kit

Human EDARADD activation kit by CRISPRa

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Human CD39 Antibody[A1]
E-AB-F1165S-01 20 Tests

Elab Fluor® Red 780 Anti-Human CD39 Antibody[A1]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Human CD39 Antibody[A1]
E-AB-F1165S-02 100 Tests

Elab Fluor® Red 780 Anti-Human CD39 Antibody[A1]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Human CD39 Antibody[A1]
E-AB-F1165S-03 2x 100 Tests

Elab Fluor® Red 780 Anti-Human CD39 Antibody[A1]

Sign In for Pricing
View Details
SIK3 Human Gene Knockout Kit (CRISPR)
KN223406 1 Kit

SIK3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/782), Biotin conjugate, 0.1mg/mL
BNCB2221-100 1x 100 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/782), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details