Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTBD15 Rabbit Polyclonal Antibody (FITC)

BTBD15 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BTBD15, ZNF851, HSPC063

UniProt

Q86XX5

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human BTBD15

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PVDSSLAFPWTFPFGIDRRIQPEKVKQAENTRTLELPGPSETGRRMADYV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_054874

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Immunoglobulin gamma2 Chain C Region ELISA Kit
MBS7258847-01 48 Well

Goat Immunoglobulin gamma2 Chain C Region ELISA Kit

Sign In for Pricing
View Details
Goat Immunoglobulin gamma2 Chain C Region ELISA Kit
MBS7258847-02 96 Well

Goat Immunoglobulin gamma2 Chain C Region ELISA Kit

Sign In for Pricing
View Details
Goat Immunoglobulin gamma2 Chain C Region ELISA Kit
MBS7258847-03 5x 96 Well

Goat Immunoglobulin gamma2 Chain C Region ELISA Kit

Sign In for Pricing
View Details
Goat Immunoglobulin gamma2 Chain C Region ELISA Kit
MBS7258847-04 10x 96 Well

Goat Immunoglobulin gamma2 Chain C Region ELISA Kit

Sign In for Pricing
View Details
SPATA7 Rabbit pAb, PE-Cy7 conjugated
orb2849931 100 µL

SPATA7 Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
SRARP (NM_178840) Human Over-expression Lysate
LS149563-20ug 20 µg

SRARP (NM_178840) Human Over-expression Lysate

Sign In for Pricing
View Details