Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTBD15 Rabbit Polyclonal Antibody (HRP)

BTBD15 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BTBD15, ZNF851, HSPC063

UniProt

Q86XX5

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human BTBD15

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PVDSSLAFPWTFPFGIDRRIQPEKVKQAENTRTLELPGPSETGRRMADYV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_054874

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-DNA Nucleotidylexotransferase Rabbit Monoclonal Antibody
MA2299-.05 50 µL

Anti-DNA Nucleotidylexotransferase Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human C-type lectin domain family 1 member B,CLEC1B ELISA KIT
JOT-EK7512Hu-01 48 Well

Human C-type lectin domain family 1 member B,CLEC1B ELISA KIT

Sign In for Pricing
View Details
Human C-type lectin domain family 1 member B,CLEC1B ELISA KIT
JOT-EK7512Hu-02 96 Well

Human C-type lectin domain family 1 member B,CLEC1B ELISA KIT

Sign In for Pricing
View Details
KCNQ3, CT (KCNQ3, Potassium voltage-gated channel subfamily KQT member 3, KQT-like 3, Potassium channel subunit alpha KvLQT3, Voltage-gated potassium channel subunit Kv7.3) (MaxLight 550)
MBS6312716-01 0.1 mL

KCNQ3, CT (KCNQ3, Potassium voltage-gated channel subfamily KQT member 3, KQT-like 3, Potassium channel subunit alpha KvLQT3, Voltage-gated potassium channel subunit Kv7.3) (MaxLight 550)

Sign In for Pricing
View Details
KCNQ3, CT (KCNQ3, Potassium voltage-gated channel subfamily KQT member 3, KQT-like 3, Potassium channel subunit alpha KvLQT3, Voltage-gated potassium channel subunit Kv7.3) (MaxLight 550)
MBS6312716-02 5x 0.1 mL

KCNQ3, CT (KCNQ3, Potassium voltage-gated channel subfamily KQT member 3, KQT-like 3, Potassium channel subunit alpha KvLQT3, Voltage-gated potassium channel subunit Kv7.3) (MaxLight 550)

Sign In for Pricing
View Details
IRF3 (Interferon Regulatory Factor 3)
247713 50 µL

IRF3 (Interferon Regulatory Factor 3)

Sign In for Pricing
View Details