Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF324 Rabbit Polyclonal Antibody (HRP)

ZNF324 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZF5128, ZNF324A

UniProt

O75467

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF324

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WERLLLGSGSGQASVSLRLTSPLRPPEGVRLREKTLTEHALLGRQPRTPE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_055162

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti- (Mouse) Med15 Antibody (C-term)
M03568-1-01 80 µL

Anti- (Mouse) Med15 Antibody (C-term)

Sign In for Pricing
View Details
Anti- (Mouse) Med15 Antibody (C-term)
M03568-1-02 400 µL

Anti- (Mouse) Med15 Antibody (C-term)

Sign In for Pricing
View Details
BCL6B Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-13606R-BF750 100 µL

BCL6B Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
PTHLH Rabbit Polyclonal Antibody
53364-01 50 µL

PTHLH Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PTHLH Rabbit Polyclonal Antibody
53364-02 100 µL

PTHLH Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RPLP1 (Ribosomal Protein, Large, P1, FLJ27448, MGC5215, P1, RPP1)
251263 100 µg

RPLP1 (Ribosomal Protein, Large, P1, FLJ27448, MGC5215, P1, RPP1)

Sign In for Pricing
View Details