Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF432 Rabbit Polyclonal Antibody (FITC)

ZNF432 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

O94892

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF432

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DERHSRICPENNEVDDHLQDHLENQRMLKSVEQYHEHNAFGNTASQTKSL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_055465

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fez1 ORF Vector (Mouse) (pORF)
20467014 1.0 µg DNA

Fez1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
ZFP36L1, NT (ZFP36L1, BERG36, BRF1, ERF1, RNF162B, TIS11B, Zinc finger protein 36, C3H1 type-like 1, Butyrate response factor 1, EGF-response factor 1, Protein TIS11B) (MaxLight 650)
MBS6365147-01 0.1 mL

ZFP36L1, NT (ZFP36L1, BERG36, BRF1, ERF1, RNF162B, TIS11B, Zinc finger protein 36, C3H1 type-like 1, Butyrate response factor 1, EGF-response factor 1, Protein TIS11B) (MaxLight 650)

Sign In for Pricing
View Details
ZFP36L1, NT (ZFP36L1, BERG36, BRF1, ERF1, RNF162B, TIS11B, Zinc finger protein 36, C3H1 type-like 1, Butyrate response factor 1, EGF-response factor 1, Protein TIS11B) (MaxLight 650)
MBS6365147-02 5x 0.1 mL

ZFP36L1, NT (ZFP36L1, BERG36, BRF1, ERF1, RNF162B, TIS11B, Zinc finger protein 36, C3H1 type-like 1, Butyrate response factor 1, EGF-response factor 1, Protein TIS11B) (MaxLight 650)

Sign In for Pricing
View Details
Goat CTP synthase 2 (CTPS2) ELISA Kit
MBS7201031-01 48 Well

Goat CTP synthase 2 (CTPS2) ELISA Kit

Sign In for Pricing
View Details
Goat CTP synthase 2 (CTPS2) ELISA Kit
MBS7201031-02 96 Well

Goat CTP synthase 2 (CTPS2) ELISA Kit

Sign In for Pricing
View Details
Goat CTP synthase 2 (CTPS2) ELISA Kit
MBS7201031-03 5x 96 Well

Goat CTP synthase 2 (CTPS2) ELISA Kit

Sign In for Pricing
View Details