Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF507 Rabbit Polyclonal Antibody (Biotin)

ZNF507 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Zfp507

UniProt

Q8TCN5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF507

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SDGQVKTGISMSLLTVIEKLRERTDQNASDDDILKELQDNAQCQPNSDTS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

106kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055725

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACVR1, ID (N99) (Activin Receptor Type 1, Activin Receptor Type I, ACTR-I, Serine/Threonine-protein Kinase Receptor R1, SKR1, Activin Receptor-like Kinase 2, ALK-2, TGF-B Superfamily Receptor Type I, TSR-I, ACVRLK2) (MaxLight 650) discontinued
A0855-95E3-ML650 100 µL

ACVR1, ID (N99) (Activin Receptor Type 1, Activin Receptor Type I, ACTR-I, Serine/Threonine-protein Kinase Receptor R1, SKR1, Activin Receptor-like Kinase 2, ALK-2, TGF-B Superfamily Receptor Type I, TSR-I, ACVRLK2) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Anti-Activin Receptor Type IIB/ACVR2B Antibody Picoband® (Dylight594 Conjugate)
PB9975-Dylight594 100 µg

Anti-Activin Receptor Type IIB/ACVR2B Antibody Picoband® (Dylight594 Conjugate)

Sign In for Pricing
View Details
Troponin T Type 2, Cardiac (TNNT2) Magnetic Fluorescence Assay Kit
MBS2159236-01 96 Tests

Troponin T Type 2, Cardiac (TNNT2) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Troponin T Type 2, Cardiac (TNNT2) Magnetic Fluorescence Assay Kit
MBS2159236-02 5x 96 Tests

Troponin T Type 2, Cardiac (TNNT2) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Troponin T Type 2, Cardiac (TNNT2) Magnetic Fluorescence Assay Kit
MBS2159236-03 10x 96 Tests

Troponin T Type 2, Cardiac (TNNT2) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Recombinant Dirofilaria immitis Glutathione peroxidase Protein, C-His
YXY00021 100 μg

Recombinant Dirofilaria immitis Glutathione peroxidase Protein, C-His

Sign In for Pricing
View Details