Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB7A Rabbit Polyclonal Antibody (HRP)

ZBTB7A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LRF, FBI1, FBI-1, TIP21, ZBTB7, ZNF857A, pokemon

UniProt

O95365

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZBTB7A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PPAERPPTGDGDEGDSNPGLWPERDEDAPTGGLFPPPVAPPAATQNGHYG

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_056982

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human EDA2R Protein
E30P1062 20 µg

Recombinant Human EDA2R Protein

Sign In for Pricing
View Details
STXBP2 Polyclonal Antibody
ANT-14601-100ug 100 µg

STXBP2 Polyclonal Antibody

Sign In for Pricing
View Details
Human ANGPTL8 Pre-designed siRNA Set B
SI000672B 1 Each

Human ANGPTL8 Pre-designed siRNA Set B

Sign In for Pricing
View Details
MUC5B Polyclonal Antibody
UB-GEN-5618 100 µL

MUC5B Polyclonal Antibody

Sign In for Pricing
View Details
9330134C04Rik antibody - C-terminal region
MBS3203150-01 0.1 mL

9330134C04Rik antibody - C-terminal region

Sign In for Pricing
View Details
9330134C04Rik antibody - C-terminal region
MBS3203150-02 5x 0.1 mL

9330134C04Rik antibody - C-terminal region

Sign In for Pricing
View Details