Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB7A Rabbit Polyclonal Antibody (HRP)

ZBTB7A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LRF, FBI1, FBI-1, TIP21, ZBTB7, ZNF857A, pokemon

UniProt

O95365

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZBTB7A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PPAERPPTGDGDEGDSNPGLWPERDEDAPTGGLFPPPVAPPAATQNGHYG

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_056982

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rad51ap1 (NM_009013) Mouse Tagged ORF Clone
MG205010 10 µg

Rad51ap1 (NM_009013) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
RAB11FIP4 (NM_032932) Human Over-expression Lysate
LS084440 100 µg

RAB11FIP4 (NM_032932) Human Over-expression Lysate

Sign In for Pricing
View Details
TRIM36 Double Nickase Plasmid (h)
sc-412543-NIC 20 µg

TRIM36 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
MTCH2 Protein Vector (Rat) (pPM-C-HA)
PV283512 500 ng

MTCH2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Saikosaponin A
166470-01 1 mg

Saikosaponin A

Sign In for Pricing
View Details
Saikosaponin A
166470-02 5 mg

Saikosaponin A

Sign In for Pricing
View Details