Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB7A Rabbit Polyclonal Antibody (HRP)

ZBTB7A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LRF, FBI1, FBI-1, TIP21, ZBTB7, ZNF857A, pokemon

UniProt

O95365

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZBTB7A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MNSLPPAAAAAAASFPWSAFGASDDDLDATKEAVAAAVAAVAAGDCNGLD

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_056982

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Semaphorin 7a (SEMA7A) (NM_003612) Human Recombinant Protein
TP310966M 100 µg

Semaphorin 7a (SEMA7A) (NM_003612) Human Recombinant Protein

Sign In for Pricing
View Details
ASB17 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV669571 1.0 µg DNA

ASB17 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Mob3a Mouse qPCR Template Standard (NM_172457)
MK202997 1 Kit

Mob3a Mouse qPCR Template Standard (NM_172457)

Sign In for Pricing
View Details
TMEM80 (NM_174940) Human Tagged ORF Clone Lentiviral Particle
RC202288L2V 200 µL

TMEM80 (NM_174940) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Monoclonal AIBZIP Antibody (PCRP-CREB3L4-1A3) [PE]
NBP3-24138PE 0.1 mL

Mouse Monoclonal AIBZIP Antibody (PCRP-CREB3L4-1A3) [PE]

Sign In for Pricing
View Details
Chst7 (NM_021715) Mouse Tagged ORF Clone
MG207747 10 µg

Chst7 (NM_021715) Mouse Tagged ORF Clone

Sign In for Pricing
View Details