Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIP4 Rabbit Polyclonal Antibody (FITC)

TRIP4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ASC1, ASC-1, MDCDC, SMABF1, ZC2HC5, HsT17391

UniProt

Q15650

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRIP4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VCEQEGSGPCLFCGTLVCTHEEQDILQRDSNKSQKLLKKLMSGVENSGKV

Field of Research

Neuroscience

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057297

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPS30 Antibody
8C16659-AAT 50 µg

MRPS30 Antibody

Sign In for Pricing
View Details
STOML2 Recombinant Antibody, RBITC Conjugated
bsm-62593R-RBITC-01 20 µL

STOML2 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
STOML2 Recombinant Antibody, RBITC Conjugated
bsm-62593R-RBITC-02 100 µL

STOML2 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Human PXMP4 knockout cell line
ABC-KH12481 1 Vial

Human PXMP4 knockout cell line

Sign In for Pricing
View Details
Recombinant Clostridium Perfringens rpsL Protein (aa 1-126) (strain ATCC 13124 / NCTC 8237 / Type A)
VAng-Lsx00827-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Perfringens rpsL Protein (aa 1-126) (strain ATCC 13124 / NCTC 8237 / Type A)

Sign In for Pricing
View Details
Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/3398), CF647 conjugate, 0.1mg/mL
BNC473398-100 1x 100 µL

Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/3398), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details