Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIP4 Rabbit Polyclonal Antibody (FITC)

TRIP4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ASC1, ASC-1, MDCDC, SMABF1, ZC2HC5, HsT17391

UniProt

Q15650

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRIP4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VCEQEGSGPCLFCGTLVCTHEEQDILQRDSNKSQKLLKKLMSGVENSGKV

Field of Research

Neuroscience

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057297

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFX1 Protein Vector (Rat) (pPM-C-HA)
PV298916 500 ng

RFX1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
TRAF2 (TNF Receptor-associated Factor 2, TRAF 2, ITRAF, I-TRAF) discontinued
219290-01 20 µL

TRAF2 (TNF Receptor-associated Factor 2, TRAF 2, ITRAF, I-TRAF) discontinued

Sign In for Pricing
View Details
TRAF2 (TNF Receptor-associated Factor 2, TRAF 2, ITRAF, I-TRAF) discontinued
219290-02 100 µL

TRAF2 (TNF Receptor-associated Factor 2, TRAF 2, ITRAF, I-TRAF) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Hist1h2bp shRNA (UAS) - Lentiviral mouseHist1h2bp shRNA (UAS, GFP) (25)
GTR15134948 1 Vial

Lentiviral mouse Hist1h2bp shRNA (UAS) - Lentiviral mouseHist1h2bp shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Rabbit Monoclonal V5 Epitope Tag Antibody (SV5-P-K) [Janelia Fluor 549]
NBP2-52653JF549 0.1 mL

Rabbit Monoclonal V5 Epitope Tag Antibody (SV5-P-K) [Janelia Fluor 549]

Sign In for Pricing
View Details
V PIC 401/1302 -200x400-B0455 V-shape & L-shape Signs
811221 1 Card (1 Panel (s) x 1 Pack)

V PIC 401/1302 -200x400-B0455 V-shape & L-shape Signs

Sign In for Pricing
View Details