Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHF20 Rabbit Polyclonal Antibody (HRP)

PHF20 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NZF, TZP, GLEA2, HCA58, TDRD20A, C20orf104

UniProt

Q9BVI0

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PHF20

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GSALDDAVNPLHENGDDSLSPRLGWPLDQDRSKGDSDPKPGSPKVKEYVS

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

83kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

EAW76154

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Respiratory syncytial virus Antibody
GWB-F37AAF 0.1 mg

Respiratory syncytial virus Antibody

Sign In for Pricing
View Details
Lentiviral mouse Fem1b shRNA (UAS) - Lentiviral mouse Fem1b shRNA (UAS, GFP) (100)
GTR15218949 1 Vial

Lentiviral mouse Fem1b shRNA (UAS) - Lentiviral mouse Fem1b shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
C9orf37 Double Nickase Plasmid (h)
sc-413762-NIC 20 µg

C9orf37 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
O6C76 Polyclonal Antibody
E11-202741 100 µg -100 µL

O6C76 Polyclonal Antibody

Sign In for Pricing
View Details
SuperCut Fast Restriciton Enzymes BsrGⅠ
8052611 300 Units

SuperCut Fast Restriciton Enzymes BsrGⅠ

Sign In for Pricing
View Details
Mouse Bard1 activation kit by CRISPRa
GA200368 1 Kit

Mouse Bard1 activation kit by CRISPRa

Sign In for Pricing
View Details