Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF416 Rabbit Polyclonal Antibody (HRP)

ZNF416 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9BWM5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF416

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QVRTPEASPSTQKIQSCDMCVPFLTDILHLTDLPGQELYLTGACAVFHQD

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_060349

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS504130 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Pyruvaldehyde (35% w/w aqueous)
TRC-P998870-1G 1 g

Pyruvaldehyde (35% w/w aqueous)

Sign In for Pricing
View Details
USP25 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F9]
TA810970BM 100 µL

USP25 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F9]

Sign In for Pricing
View Details
Sowaha Mouse Gene Knockout Kit (CRISPR)
KN516482 1 Kit

Sowaha Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human GGA1, C-His Tag
HA210748-01 20 µg

Human GGA1, C-His Tag

Sign In for Pricing
View Details
Human GGA1, C-His Tag
HA210748-02 50 µg

Human GGA1, C-His Tag

Sign In for Pricing
View Details