Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF416 Rabbit Polyclonal Antibody (Biotin)

ZNF416 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q9BWM5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF416

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QVRTPEASPSTQKIQSCDMCVPFLTDILHLTDLPGQELYLTGACAVFHQD

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_060349

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse PODXL Protein, N-GST & C-His
orb3056622-01 50 µg

Recombinant Mouse PODXL Protein, N-GST & C-His

Sign In for Pricing
View Details
Recombinant Mouse PODXL Protein, N-GST & C-His
orb3056622-02 100 µg

Recombinant Mouse PODXL Protein, N-GST & C-His

Sign In for Pricing
View Details
Recombinant Mouse PODXL Protein, N-GST & C-His
orb3056622-03 1 mg

Recombinant Mouse PODXL Protein, N-GST & C-His

Sign In for Pricing
View Details
1L AccuGel 19:1 (30%)
NAT1178 1 L

1L AccuGel 19:1 (30%)

Sign In for Pricing
View Details
FERMT2, CT (FERMT2, KIND2, MIG2, PLEKHC1, Fermitin family homolog 2, Kindlin-2, Mitogen-inducible gene 2 protein, Pleckstrin homology domain-containing family C member 1) (Biotin) discontinued
035601-Biotin 200 µL

FERMT2, CT (FERMT2, KIND2, MIG2, PLEKHC1, Fermitin family homolog 2, Kindlin-2, Mitogen-inducible gene 2 protein, Pleckstrin homology domain-containing family C member 1) (Biotin) discontinued

Sign In for Pricing
View Details
RPL35AP4 Protein Lysate (Human) with C-Ha Tag
41518031 100 µg

RPL35AP4 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details