Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF416 Rabbit Polyclonal Antibody (Biotin)

ZNF416 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q9BWM5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF416

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QVRTPEASPSTQKIQSCDMCVPFLTDILHLTDLPGQELYLTGACAVFHQD

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_060349

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine B Cell Activation Factor ELISA kit
GTR10459960 96 Well

Bovine B Cell Activation Factor ELISA kit

Sign In for Pricing
View Details
CD101 Antibody
E10-31617 100 µL

CD101 Antibody

Sign In for Pricing
View Details
VPS33B Double Nickase Plasmid (h)
sc-406200-NIC 20 µg

VPS33B Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Rat Glutamate receptor, ionotropic kainate 5 (GRIK5) ELISA Kit
MBS7206679-01 48 Well

Rat Glutamate receptor, ionotropic kainate 5 (GRIK5) ELISA Kit

Sign In for Pricing
View Details
Rat Glutamate receptor, ionotropic kainate 5 (GRIK5) ELISA Kit
MBS7206679-02 96 Well

Rat Glutamate receptor, ionotropic kainate 5 (GRIK5) ELISA Kit

Sign In for Pricing
View Details
Rat Glutamate receptor, ionotropic kainate 5 (GRIK5) ELISA Kit
MBS7206679-03 5x 96 Well

Rat Glutamate receptor, ionotropic kainate 5 (GRIK5) ELISA Kit

Sign In for Pricing
View Details