Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF307 Rabbit Polyclonal Antibody (HRP)

ZNF307 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZNF307, ZNF427, ZSCAN36, P1P373C6

UniProt

Q969J2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF307

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PVKKLPEKEHGKICHLREDIAQIPTHAEAGEQEGRLQRKQKNAIGSRRHY

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine

Tested Applications

WB

NCBI Accession Number

NP_061983

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMO2 Protein Vector (Human) (pPB-C-His)
PV023877 500 ng

LMO2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
ST13P20 3'UTR Lenti-reporter-Luc Vector
45614081 1.0 µg

ST13P20 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Recombinant Anthopleura elegantissima Toxin APE 2-1
MBS1145707-01 0.02 mg (E-Coli)

Recombinant Anthopleura elegantissima Toxin APE 2-1

Sign In for Pricing
View Details
Recombinant Anthopleura elegantissima Toxin APE 2-1
MBS1145707-02 0.1 mg (E-Coli)

Recombinant Anthopleura elegantissima Toxin APE 2-1

Sign In for Pricing
View Details
Recombinant Anthopleura elegantissima Toxin APE 2-1
MBS1145707-03 0.02 mg (Yeast)

Recombinant Anthopleura elegantissima Toxin APE 2-1

Sign In for Pricing
View Details
Recombinant Anthopleura elegantissima Toxin APE 2-1
MBS1145707-04 0.1 mg (Yeast)

Recombinant Anthopleura elegantissima Toxin APE 2-1

Sign In for Pricing
View Details