Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF307 Rabbit Polyclonal Antibody (HRP)

ZNF307 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZNF307, ZNF427, ZSCAN36, P1P373C6

UniProt

Q969J2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF307

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PVKKLPEKEHGKICHLREDIAQIPTHAEAGEQEGRLQRKQKNAIGSRRHY

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine

Tested Applications

WB

NCBI Accession Number

NP_061983

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

A77 1726
1973-5 5 mg

A77 1726

Sign In for Pricing
View Details
Human MIP3a (Macrophage Inflammatory Protein 3 Alpha) ELISA Kit
EH25544 96 Tests

Human MIP3a (Macrophage Inflammatory Protein 3 Alpha) ELISA Kit

Sign In for Pricing
View Details
LOC688430 3'UTR Luciferase Stable Cell Line
TU211708 1.0 mL

LOC688430 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Monkey COMM domain containing protein 6 (COMMD6) ELISA Kit
GTR10356584 96 Well

Monkey COMM domain containing protein 6 (COMMD6) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal SHISA5 Antibody [DyLight 550]
NBP2-97841R 0.1 mL

Rabbit Polyclonal SHISA5 Antibody [DyLight 550]

Sign In for Pricing
View Details
Renilla Luciferase Reporter Gene Assay Cell Lysis Buffer
RG129M 100 mL

Renilla Luciferase Reporter Gene Assay Cell Lysis Buffer

Sign In for Pricing
View Details