Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF529 Rabbit Polyclonal Antibody (HRP)

ZNF529 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KIAA1615

UniProt

Q9H731

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF529

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QMKIISENVPSYKTHESLTLPRRTHDSEKPYEYKEYEKVFSCDLEFDEYQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_066002

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Vesicle Associated Membrane Protein 3 ELISA Kit
GTR10354941 96 Well

Canine Vesicle Associated Membrane Protein 3 ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Lynx1 shRNA (UAS) - Lentiviral mouse Lynx1 shRNA (UAS, GFP) plasmid
GTR15200830 1 Vial

Lentiviral mouse Lynx1 shRNA (UAS) - Lentiviral mouse Lynx1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
SPP1 (Secreted Phosphoprotein 1, BNSP, BSPI, ETA-1, MGC110940, OPN) (MaxLight 550)
252059-ML550 100 µL

SPP1 (Secreted Phosphoprotein 1, BNSP, BSPI, ETA-1, MGC110940, OPN) (MaxLight 550)

Sign In for Pricing
View Details
Recombinant Yersinia pestis Rhamnulose-1-phosphate aldolase (rhaD)
MBS1175915-01 0.02 mg (E-Coli)

Recombinant Yersinia pestis Rhamnulose-1-phosphate aldolase (rhaD)

Sign In for Pricing
View Details
Recombinant Yersinia pestis Rhamnulose-1-phosphate aldolase (rhaD)
MBS1175915-02 0.02 mg (Yeast)

Recombinant Yersinia pestis Rhamnulose-1-phosphate aldolase (rhaD)

Sign In for Pricing
View Details
Recombinant Yersinia pestis Rhamnulose-1-phosphate aldolase (rhaD)
MBS1175915-03 0.1 mg (E-Coli)

Recombinant Yersinia pestis Rhamnulose-1-phosphate aldolase (rhaD)

Sign In for Pricing
View Details