Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF2 Rabbit Polyclonal Antibody (HRP)

ZNF2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

A1-5, ZNF661, Zfp661

UniProt

Q9BSG1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KFEVHTPNGRMGTEKQSPSGETRKKSLSRDKGLRRRSALSREILTKERHQ

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_066574

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-WDR7 Antibody Picoband® Fluoro488 Conjugated
A14596-1-Fluoro488 100 µg/Vial

Anti-WDR7 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
CEBPA, CT (CEBPA, CCAAT/enhancer-binding protein alpha) (MaxLight 650)
MBS6284960-01 0.1 mL

CEBPA, CT (CEBPA, CCAAT/enhancer-binding protein alpha) (MaxLight 650)

Sign In for Pricing
View Details
CEBPA, CT (CEBPA, CCAAT/enhancer-binding protein alpha) (MaxLight 650)
MBS6284960-02 5x 0.1 mL

CEBPA, CT (CEBPA, CCAAT/enhancer-binding protein alpha) (MaxLight 650)

Sign In for Pricing
View Details
Zfp385d Rat shRNA Plasmid (Locus ID 305691)
TR702126 1 Kit

Zfp385d Rat shRNA Plasmid (Locus ID 305691)

Sign In for Pricing
View Details
U2AF2 Antibody
orb1242216 100 µL

U2AF2 Antibody

Sign In for Pricing
View Details
Popular range Protein Marker: 14-66 kDa
78084 0.5 ml

Popular range Protein Marker: 14-66 kDa

Sign In for Pricing
View Details