Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF77 Rabbit Polyclonal Antibody (HRP)

ZNF77 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PT1

UniProt

Q15935

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF77

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LCESNEGHQCGETLSQTANLLVHKSYPTEAKPSECTKCGKAFENRQRSHT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_067040

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ML095 HCl 5mg
A22545-5 5 mg

ML095 HCl 5mg

Sign In for Pricing
View Details
Specificity Protein 1 Phospho-Thr739 (SP1 pT739) Antibody
abx330017-01 50 µg

Specificity Protein 1 Phospho-Thr739 (SP1 pT739) Antibody

Sign In for Pricing
View Details
Specificity Protein 1 Phospho-Thr739 (SP1 pT739) Antibody
abx330017-02 100 µg

Specificity Protein 1 Phospho-Thr739 (SP1 pT739) Antibody

Sign In for Pricing
View Details
Rabbit anti-human Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase polyclonal Antibody, Biotin conjugated
MBS1491199-01 0.05 mg

Rabbit anti-human Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-human Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase polyclonal Antibody, Biotin conjugated
MBS1491199-02 0.1 mg

Rabbit anti-human Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-human Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase polyclonal Antibody, Biotin conjugated
MBS1491199-03 5x 0.1 mg

Rabbit anti-human Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details