Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCAND2 Rabbit Polyclonal Antibody (HRP)

SCAND2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SCAND2

UniProt

Q9GZW5

Immunogen

The immunogen is a synthetic peptide directed towards the n terminal region of human SCAND2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAVAVDQQIQTPSVQDLQIVKLEEDSHWEQEISLQGNYPGPETSCQSFWH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_071333

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Heparanase 1 (HPSE) Human Over-expression Lysate
orb1357276 100 µg

Heparanase 1 (HPSE) Human Over-expression Lysate

Sign In for Pricing
View Details
MDFI discontinued
391466 200 µL

MDFI discontinued

Sign In for Pricing
View Details
PD-L1/B7-H1/CD274, Recombinant, Human, Extra Cellular Domain, ECD, mFc-Tag, Active discontinued
046335 100 µg

PD-L1/B7-H1/CD274, Recombinant, Human, Extra Cellular Domain, ECD, mFc-Tag, Active discontinued

Sign In for Pricing
View Details
ING1 (Inhibitor of Growth Family, Member 1, OTTHUMP00000018703, OTTHUMP00000018704, OTTHUMP00000018705, OTTHUMP00000018706, Growth Inhibitor ING1, Growth Inhibitory Protein ING1, Inhibitor of Growth 1, Tumor suppressor ING1, p24ING1c, p33, p33ING1, p33ING
MBS6215525-01 0.1 mL

ING1 (Inhibitor of Growth Family, Member 1, OTTHUMP00000018703, OTTHUMP00000018704, OTTHUMP00000018705, OTTHUMP00000018706, Growth Inhibitor ING1, Growth Inhibitory Protein ING1, Inhibitor of Growth 1, Tumor suppressor ING1, p24ING1c, p33, p33ING1, p33ING

Sign In for Pricing
View Details
ING1 (Inhibitor of Growth Family, Member 1, OTTHUMP00000018703, OTTHUMP00000018704, OTTHUMP00000018705, OTTHUMP00000018706, Growth Inhibitor ING1, Growth Inhibitory Protein ING1, Inhibitor of Growth 1, Tumor suppressor ING1, p24ING1c, p33, p33ING1, p33ING
MBS6215525-02 5x 0.1 mL

ING1 (Inhibitor of Growth Family, Member 1, OTTHUMP00000018703, OTTHUMP00000018704, OTTHUMP00000018705, OTTHUMP00000018706, Growth Inhibitor ING1, Growth Inhibitory Protein ING1, Inhibitor of Growth 1, Tumor suppressor ING1, p24ING1c, p33, p33ING1, p33ING

Sign In for Pricing
View Details
Recombinant Integrin Alpha M (CD11b)
TRV-0011732-01 10 µg

Recombinant Integrin Alpha M (CD11b)

Sign In for Pricing
View Details