Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EBF2 Rabbit Polyclonal Antibody (HRP)

EBF2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

COE2, OE-3, EBF-2, O/E-3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human EBF2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VPRNPSQLPALSSSPAHSGMMGINSYGSQLGVSISESTQGNNQGYIRNTS

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

XP_944784

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Flagellar filament 35 kDa core protein (flaB), Partial
orb2659406-01 20 µg

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Flagellar filament 35 kDa core protein (flaB), Partial

Sign In for Pricing
View Details
Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Flagellar filament 35 kDa core protein (flaB), Partial
orb2659406-02 100 µg

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Flagellar filament 35 kDa core protein (flaB), Partial

Sign In for Pricing
View Details
Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Flagellar filament 35 kDa core protein (flaB), Partial
orb2659406-03 1 mg

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Flagellar filament 35 kDa core protein (flaB), Partial

Sign In for Pricing
View Details
Tirasemtiv
467667-01 25 mg

Tirasemtiv

Sign In for Pricing
View Details
Tirasemtiv
467667-02 250 mg

Tirasemtiv

Sign In for Pricing
View Details
RSV Antibody
orb3131424-01 1 mg

RSV Antibody

Sign In for Pricing
View Details