Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EBF2 Rabbit Polyclonal Antibody (FITC)

EBF2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

COE2, OE-3, EBF-2, O/E-3

UniProt

Q9HAK2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human EBF2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GDPERLAKEMLLKRAADLVEALYGTPHNNQDIILKRAADIAEALYSVPRN

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_073150

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMC1A Monoclonal Antibody
MBS7135434-01 0.1 mL

SMC1A Monoclonal Antibody

Sign In for Pricing
View Details
SMC1A Monoclonal Antibody
MBS7135434-02 5x 0.1 mL

SMC1A Monoclonal Antibody

Sign In for Pricing
View Details
Human MAPK/MAK/MRK overlapping kinase (RAGE) ELISA Kit
KTE60980-01 48 Tests

Human MAPK/MAK/MRK overlapping kinase (RAGE) ELISA Kit

Sign In for Pricing
View Details
Human MAPK/MAK/MRK overlapping kinase (RAGE) ELISA Kit
KTE60980-02 96 Tests

Human MAPK/MAK/MRK overlapping kinase (RAGE) ELISA Kit

Sign In for Pricing
View Details
Human MAPK/MAK/MRK overlapping kinase (RAGE) ELISA Kit
KTE60980-03 5x 96 Tests

Human MAPK/MAK/MRK overlapping kinase (RAGE) ELISA Kit

Sign In for Pricing
View Details
Human MAPK/MAK/MRK overlapping kinase (RAGE) ELISA Kit
KTE60980-04 50x 96 Tests

Human MAPK/MAK/MRK overlapping kinase (RAGE) ELISA Kit

Sign In for Pricing
View Details