Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EBF2 Rabbit Polyclonal Antibody (HRP)

EBF2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

COE2, OE-3, EBF-2, O/E-3

UniProt

Q9HAK2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human EBF2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GDPERLAKEMLLKRAADLVEALYGTPHNNQDIILKRAADIAEALYSVPRN

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_073150

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig Myelin Associated Glycoprotein Antibody (MAG Ab) ELISA Kit
MBS266136-01 48 Well

Guinea pig Myelin Associated Glycoprotein Antibody (MAG Ab) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Myelin Associated Glycoprotein Antibody (MAG Ab) ELISA Kit
MBS266136-02 96 Well

Guinea pig Myelin Associated Glycoprotein Antibody (MAG Ab) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Myelin Associated Glycoprotein Antibody (MAG Ab) ELISA Kit
MBS266136-03 5x 96 Well

Guinea pig Myelin Associated Glycoprotein Antibody (MAG Ab) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Myelin Associated Glycoprotein Antibody (MAG Ab) ELISA Kit
MBS266136-04 10x 96 Well

Guinea pig Myelin Associated Glycoprotein Antibody (MAG Ab) ELISA Kit

Sign In for Pricing
View Details
PIK3AP1 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2522504 100 µL

PIK3AP1 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Anti-SLC25A29 Antibody Picoband®, Dylight550 Conjugate
A11796-1-Dylight550 100 µg

Anti-SLC25A29 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details