Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLJ12644 Rabbit Polyclonal Antibody (FITC)

FLJ12644 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q9H9N2

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human FLJ12644

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EKAYFYMSCLVKHKRIHSREKRGDSVKVENPSTASHSLSPSEHVQGKSPV

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_075562

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C3orf26 (CMSS1) (NM_001167924) Human Over-expression Lysate
LC432783 20 µg

C3orf26 (CMSS1) (NM_001167924) Human Over-expression Lysate

Sign In for Pricing
View Details
HER-4 / ERBB4 (ERBB4/2581), CF740 conjugate, 0.1mg/mL
BNC742581-500 1x 500 µL

HER-4 / ERBB4 (ERBB4/2581), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Pur B (PURB) activation kit by CRISPRa
GA103953 1 Kit

Human Pur B (PURB) activation kit by CRISPRa

Sign In for Pricing
View Details
Human CD80 Recombinant Rabbit monoclonal Antibody
HA723123 100 µL

Human CD80 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
OSTA (SLC51A) Human Gene Knockout Kit (CRISPR)
KN419313 1 Kit

OSTA (SLC51A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RDH11 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B4]
TA501053AM 100 µL

RDH11 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B4]

Sign In for Pricing
View Details