Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLJ12644 Rabbit Polyclonal Antibody (HRP)

FLJ12644 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9H9N2

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human FLJ12644

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EKAYFYMSCLVKHKRIHSREKRGDSVKVENPSTASHSLSPSEHVQGKSPV

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_075562

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CACNG6 (NM_145814) Human Tagged ORF Clone Lentiviral Particle
RC205809L4V 200 µL

CACNG6 (NM_145814) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ZymoBIOMICS 96 MagBead DNA/RNA Kit (4 x 96 Preps.)
R2136 4x 96 Preparations

ZymoBIOMICS 96 MagBead DNA/RNA Kit (4 x 96 Preps.)

Sign In for Pricing
View Details
Hdlbp sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4959103 1.0 µg DNA

Hdlbp sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
4-Hydroxytryptamine creatinine sulfate
orb1984459-01 25 mg

4-Hydroxytryptamine creatinine sulfate

Sign In for Pricing
View Details
4-Hydroxytryptamine creatinine sulfate
orb1984459-02 50 mg

4-Hydroxytryptamine creatinine sulfate

Sign In for Pricing
View Details
4-Hydroxytryptamine creatinine sulfate
orb1984459-03 100 mg

4-Hydroxytryptamine creatinine sulfate

Sign In for Pricing
View Details