Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LASS4 Rabbit Polyclonal Antibody (Biotin)

LASS4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Trh1, LASS4

UniProt

Q9HA82

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human LASS4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MLYSFMKKGQMEKDIRSDVEESDSSEEAAAAQEPLQLKNGAAGGPRPAPT

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_078828

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hnRNP F (HNRNPF) (NM_001098207) Human Tagged ORF Clone Lentiviral Particle
RC213874L4V 200 µL

hnRNP F (HNRNPF) (NM_001098207) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lentiviral human EHBP1L1 sgRNA gene knockout kit - Lentiviral human EHBP1L1 sgRNA gene knockout kit (100)
GTR15362689 1 Vial

Lentiviral human EHBP1L1 sgRNA gene knockout kit - Lentiviral human EHBP1L1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Mouse RIMS3 siRNA
abx931541-01 15 nmol

Mouse RIMS3 siRNA

Sign In for Pricing
View Details
Mouse RIMS3 siRNA
abx931541-02 30 nmol

Mouse RIMS3 siRNA

Sign In for Pricing
View Details
ZNF132 (NM_003433) Human Recombinant Protein
E45H31565E1 50 µg

ZNF132 (NM_003433) Human Recombinant Protein

Sign In for Pricing
View Details
Folr1 Mouse shRNA Plasmid (Locus ID 14275)
TR515875 1 Kit

Folr1 Mouse shRNA Plasmid (Locus ID 14275)

Sign In for Pricing
View Details