Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF322A Rabbit Polyclonal Antibody (HRP)

ZNF322A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HCG12, ZNF388, ZNF489, ZNF322A

UniProt

Q6U7Q0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF322A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RTHTGEKPYKCDMCEKTFVQSSDLTSHQRIHNYEKPYKCSKCEKSFWHHL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_078915

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Placenta Growth Factor ELISA Kit
MBS004991-01 48 Well

Hamster Placenta Growth Factor ELISA Kit

Sign In for Pricing
View Details
Hamster Placenta Growth Factor ELISA Kit
MBS004991-02 96 Well

Hamster Placenta Growth Factor ELISA Kit

Sign In for Pricing
View Details
Hamster Placenta Growth Factor ELISA Kit
MBS004991-03 5x 96 Well

Hamster Placenta Growth Factor ELISA Kit

Sign In for Pricing
View Details
Hamster Placenta Growth Factor ELISA Kit
MBS004991-04 10x 96 Well

Hamster Placenta Growth Factor ELISA Kit

Sign In for Pricing
View Details
Fluoresceinamine, Isomer 1
TRC-F485300-250MG 250 mg

Fluoresceinamine, Isomer 1

Sign In for Pricing
View Details
Recombinant Human Natural Killer Cell Receptor 2B4/SLAMF4/CD244 Protein (C-6His)
ARP4955-01 10 µg

Recombinant Human Natural Killer Cell Receptor 2B4/SLAMF4/CD244 Protein (C-6His)

Sign In for Pricing
View Details