Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF665 Rabbit Polyclonal Antibody (HRP)

ZNF665 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZFP160L

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF665

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LGVSFQSHLPELQQFQREGKIYEYNQVEKSPNNRGKHYKCDECGKVFSQN

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

78kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Ovary: right
CB501073 1 Block

Frozen Tissue Blocks, Ovary: right

Sign In for Pricing
View Details
Phospho-MYL9 (T18 + S19) Recombinant Rabbit monoclonal Antibody
HA723482 100 µL

Phospho-MYL9 (T18 + S19) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Neurofilament (NF-L) (NR-4), CF594 conjugate, 0.1mg/mL
BNC940303-100 1x 100 µL

Neurofilament (NF-L) (NR-4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CELA3B / ELA3B (Pancreatic Function Marker) (rCELA3B/1811), CF568 conjugate, 0.1mg/mL
BNC683435-100 1x 100 µL

CELA3B / ELA3B (Pancreatic Function Marker) (rCELA3B/1811), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HEAB (CLP1) Mouse Monoclonal Antibody [Clone ID: OTI1H7]
CF809653 100 µg

HEAB (CLP1) Mouse Monoclonal Antibody [Clone ID: OTI1H7]

Sign In for Pricing
View Details
Cytochrome P450 4A (CYP4A11) Rabbit Polyclonal Antibody
AP14735PU-N 400 µL

Cytochrome P450 4A (CYP4A11) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details