Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF665 Rabbit Polyclonal Antibody (HRP)

ZNF665 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZFP160L

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF665

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LGVSFQSHLPELQQFQREGKIYEYNQVEKSPNNRGKHYKCDECGKVFSQN

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

78kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human USP27X activation kit by CRISPRa
GA118085 1 Kit

Human USP27X activation kit by CRISPRa

Sign In for Pricing
View Details
3-(3-(tert-Butylamino)-2-hydroxypropoxy)-4-chlorobenzoic Acid Ethyl Ester
TRC-B692255-5MG 5 mg

3-(3-(tert-Butylamino)-2-hydroxypropoxy)-4-chlorobenzoic Acid Ethyl Ester

Sign In for Pricing
View Details
IL-11RA Recombinant Rabbit Monoclonal Antibody [JE53-88]
HA720044 100 µL

IL-11RA Recombinant Rabbit Monoclonal Antibody [JE53-88]

Sign In for Pricing
View Details
Recombinant Human PAK3 Protein (His Tag)
PKSH030366 50 µg

Recombinant Human PAK3 Protein (His Tag)

Sign In for Pricing
View Details
Chromogranin A (CHGA/798), CF488A conjugate, 0.1mg/mL
BNC880798-500 1x 500 µL

Chromogranin A (CHGA/798), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (QBEnd/10 + HPCA1/763), CF568 conjugate, 0.1mg/mL
BNC680904-500 1x 500 µL

CD34 (QBEnd/10 + HPCA1/763), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details