Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF665 Rabbit Polyclonal Antibody (Biotin)

ZNF665 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZFP160L

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF665

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LGVSFQSHLPELQQFQREGKIYEYNQVEKSPNNRGKHYKCDECGKVFSQN

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

78kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H2-D1 Antibody
A51782-100UG 100 µg

H2-D1 Antibody

Sign In for Pricing
View Details
CD20/MS4A1 Rabbit Polyclonal Antibody
orb738456 100 µg

CD20/MS4A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Perilipin Immunizing Peptide
MBS428022-01 0.1 mg

Perilipin Immunizing Peptide

Sign In for Pricing
View Details
Perilipin Immunizing Peptide
MBS428022-02 5x 0.1 mg

Perilipin Immunizing Peptide

Sign In for Pricing
View Details
Interleukin 13 (IL13) Magnetic Luminex Assay Kit
LKU600172 96 Tests

Interleukin 13 (IL13) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
Sodium acetate trihydrate, meets analytical specification of Ph. Eur. BP USP FCC E262, ≤0.00002% Al
HY-Y1325H 100 g

Sodium acetate trihydrate, meets analytical specification of Ph. Eur. BP USP FCC E262, ≤0.00002% Al

Sign In for Pricing
View Details