Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF665 Rabbit Polyclonal Antibody (FITC)

ZNF665 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ZFP160L

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF665

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CGKAFTVRSNLTIHQVIHTGEKPYKCNECGKVFSQPSNLAGHQRIHTGEK

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

78kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX5 / BSAP (Early B-Cell Marker) (PAX5/2595), 0.2mg/mL
BNUB2595-100 1x 100 µL

PAX5 / BSAP (Early B-Cell Marker) (PAX5/2595), 0.2mg/mL

Sign In for Pricing
View Details
XFD568 NHS Ester
1823-AAT 1 mg

XFD568 NHS Ester

Sign In for Pricing
View Details
Mouse Cnbp activation kit by CRISPRa
GA200782 1 Kit

Mouse Cnbp activation kit by CRISPRa

Sign In for Pricing
View Details
XBP1 Human Gene Knockout Kit (CRISPR)
KN401959 1 Kit

XBP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TLR5 Recombinant Rabbit Monoclonal Antibody [JM10-88]
ET1703-30 100 µL

TLR5 Recombinant Rabbit Monoclonal Antibody [JM10-88]

Sign In for Pricing
View Details
Tube Furnace BFTU-1100-100-800
BFTU-1100-100-800 1 Unit

Tube Furnace BFTU-1100-100-800

Sign In for Pricing
View Details