Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF665 Rabbit Polyclonal Antibody (FITC)

ZNF665 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ZFP160L

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF665

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CGKAFTVRSNLTIHQVIHTGEKPYKCNECGKVFSQPSNLAGHQRIHTGEK

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

78kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 Tumor Suppressor Protein (rTP53/1739), 1mg/mL
BNUM2091-50 1x 50 µL

P53 Tumor Suppressor Protein (rTP53/1739), 1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (VWF635), CF640R conjugate, 0.1mg/mL
BNC400635-100 1x 100 µL

Von Willebrand Factor (VWF635), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BID (NM_001196) Human Recombinant Protein
TP307261L 1 mg

BID (NM_001196) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Scgb1b27 activation kit by CRISPRa
GA200012 1 Kit

Mouse Scgb1b27 activation kit by CRISPRa

Sign In for Pricing
View Details
JIP1 (MAPK8IP1) (NM_005456) Human Recombinant Protein
TP309734M 100 µg

JIP1 (MAPK8IP1) (NM_005456) Human Recombinant Protein

Sign In for Pricing
View Details
C3orf38 Polyclonal Antibody
E-AB-52504-01 20 µL

C3orf38 Polyclonal Antibody

Sign In for Pricing
View Details