Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF323 Rabbit Polyclonal Antibody (FITC)

ZNF323 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ZNF323, ZNF310P, ZNF20-Lp

UniProt

Q96LW9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF323

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QEILKEMEHLGDSKLQRDVSLDSKYRETCKRDSKAEKQQAHSTGERRHRC

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_665916

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM193A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2770107 1.0 µg DNA

FAM193A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
SPRYD5, NT (TRIM51, SPRYD5, Tripartite motif-containing protein 51, SPRY domain-containing protein 5) (MaxLight 550) discontinued
042272-ML550 100 µL

SPRYD5, NT (TRIM51, SPRYD5, Tripartite motif-containing protein 51, SPRY domain-containing protein 5) (MaxLight 550) discontinued

Sign In for Pricing
View Details
ACCN2 (ASIC1) (NM_001095) Human Tagged ORF Clone Lentiviral Particle
RC217623L3V 200 µL

ACCN2 (ASIC1) (NM_001095) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
OS9 Recombinant Antibody, Cy5 Conjugated
bsm-61925R-Cy5-01 20 µL

OS9 Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
OS9 Recombinant Antibody, Cy5 Conjugated
bsm-61925R-Cy5-02 100 µL

OS9 Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Human IL-4 Allophycocyanin Antibody (Clone 1067629)
IC11474A-100 100 Tests

Human IL-4 Allophycocyanin Antibody (Clone 1067629)

Sign In for Pricing
View Details