Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF528 Rabbit Polyclonal Antibody (HRP)

ZNF528 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KIAA1827, MGC126761, MGC138155

UniProt

Q3MIS6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF528

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LTSHQRIHTRERPYGCSQCGKIFSQKSDLIRHRKTHTDEKPYKCNKCGTA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115799

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

THAP1 (THAP Domain-containing Protein 1, DYT6)
368950 100 µL

THAP1 (THAP Domain-containing Protein 1, DYT6)

Sign In for Pricing
View Details
Recombinant Salmonella typhimurium L-rhamnonate dehydratase (rhmD)
MBS1455940-01 0.02 mg (E-Coli)

Recombinant Salmonella typhimurium L-rhamnonate dehydratase (rhmD)

Sign In for Pricing
View Details
Recombinant Salmonella typhimurium L-rhamnonate dehydratase (rhmD)
MBS1455940-02 0.02 mg (Yeast)

Recombinant Salmonella typhimurium L-rhamnonate dehydratase (rhmD)

Sign In for Pricing
View Details
Recombinant Salmonella typhimurium L-rhamnonate dehydratase (rhmD)
MBS1455940-03 0.1 mg (E-Coli)

Recombinant Salmonella typhimurium L-rhamnonate dehydratase (rhmD)

Sign In for Pricing
View Details
Recombinant Salmonella typhimurium L-rhamnonate dehydratase (rhmD)
MBS1455940-04 0.1 mg (Yeast)

Recombinant Salmonella typhimurium L-rhamnonate dehydratase (rhmD)

Sign In for Pricing
View Details
Recombinant Salmonella typhimurium L-rhamnonate dehydratase (rhmD)
MBS1455940-05 0.02 mg (Baculovirus)

Recombinant Salmonella typhimurium L-rhamnonate dehydratase (rhmD)

Sign In for Pricing
View Details