Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF607 Rabbit Polyclonal Antibody (HRP)

ZNF607 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q96SK3

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF607

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HQGIHSGKKPYECNKCGKSFRLNSSLKIHQNIHTGEKPYKCKECGKAFSQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Porcine, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MERTK/Mer Protein
PKSH031699 100 µg

Recombinant Human MERTK/Mer Protein

Sign In for Pricing
View Details
NSMAF (NM_003580) Human Recombinant Protein
TP307925M 100 µg

NSMAF (NM_003580) Human Recombinant Protein

Sign In for Pricing
View Details
Mag-520™ AM
20406-AAT 10x 50 µg

Mag-520™ AM

Sign In for Pricing
View Details
Tyramide Amplification Kit with HRP Goat Anti-Mouse and Biotin-XX Tyramide
#33018 1 Kit

Tyramide Amplification Kit with HRP Goat Anti-Mouse and Biotin-XX Tyramide

Sign In for Pricing
View Details
LAMP2 Human Knockdown Lysate
LY300363 100 µg

LAMP2 Human Knockdown Lysate

Sign In for Pricing
View Details
Glucose 6 phosphate isomerase (GPI) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7G10]
TA501136BM 100 µL

Glucose 6 phosphate isomerase (GPI) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7G10]

Sign In for Pricing
View Details