Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF607 Rabbit Polyclonal Antibody (Biotin)

ZNF607 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q96SK3

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF607

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HQGIHSGKKPYECNKCGKSFRLNSSLKIHQNIHTGEKPYKCKECGKAFSQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Porcine, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC71 (NM_022903) Human Over-expression Lysate
LS064925-100ug 100 µg

CCDC71 (NM_022903) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Myosin Regulatory Light Polypeptide 9 (MYL9) ELISA Kit
MBS9715101-01 48 Tests

Human Myosin Regulatory Light Polypeptide 9 (MYL9) ELISA Kit

Sign In for Pricing
View Details
Human Myosin Regulatory Light Polypeptide 9 (MYL9) ELISA Kit
MBS9715101-02 96 Tests

Human Myosin Regulatory Light Polypeptide 9 (MYL9) ELISA Kit

Sign In for Pricing
View Details
Human Myosin Regulatory Light Polypeptide 9 (MYL9) ELISA Kit
MBS9715101-03 5x 96 Tests

Human Myosin Regulatory Light Polypeptide 9 (MYL9) ELISA Kit

Sign In for Pricing
View Details
EPHB2 Antibody
CSB-PA945346 100 µL

EPHB2 Antibody

Sign In for Pricing
View Details
C22orf28 (RTCB) (NM_014306) Human Over-expression Lysate
LS051493-100ug 100 µg

C22orf28 (RTCB) (NM_014306) Human Over-expression Lysate

Sign In for Pricing
View Details