Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF514 Rabbit Polyclonal Antibody (HRP)

ZNF514 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC126229, MGC126230

UniProt

Q96K75

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF514

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HSDWKRRSKSKESMPSWGISKEELFQVVSVEKHIQDVLQFSKLKAACGCD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_116177

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (YBX1/2430), CF405S conjugate, 0.1mg/mL
BNC042430-100 1x 100 µL

YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (YBX1/2430), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(R)-(-)-3-Hydroxypyrrolidine Hydrochloride
TRC-H953050-25G 25 g

(R)-(-)-3-Hydroxypyrrolidine Hydrochloride

Sign In for Pricing
View Details
6-Oxopiperidine-3-carboxylic Acid
TRC-O858828-50MG 50 mg

6-Oxopiperidine-3-carboxylic Acid

Sign In for Pricing
View Details
Cytokeratin 19 (Ks19.1), CF594 conjugate, 0.1mg/mL
BNC940394-500 1x 500 µL

Cytokeratin 19 (Ks19.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Uncoated Mouse LIF (Leukemia Inhibitory Factor) ELISA Kit
E-UNEL-M0119-01 5x 96 Tests

Uncoated Mouse LIF (Leukemia Inhibitory Factor) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse LIF (Leukemia Inhibitory Factor) ELISA Kit
E-UNEL-M0119-02 15x 96 Tests

Uncoated Mouse LIF (Leukemia Inhibitory Factor) ELISA Kit

Sign In for Pricing
View Details