Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF566 Rabbit Polyclonal Antibody (HRP)

ZNF566 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ14779, MGC12515

UniProt

Q969W8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF566

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VFTHEDLPTLSHHPSFTLQQIINSKKKFCASKEYRKTFRHGSQFATHEII

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_116227

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDRG3 Recombinant Antibody, RBITC Conjugated
bsm-62515R-RBITC 100 µL

NDRG3 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
ACP1 (Low Molecular Weight Phosphotyrosine Protein Phosphatase, LMW-PTP, LMW-PTPase, Low Molecular Weight Cytosolic Acid Phosphatase, Red Cell Acid Phosphatase 1, PTPase, Adipocyte Acid Phosphatase) (MaxLight 750)
MBS6231407-01 0.1 mL

ACP1 (Low Molecular Weight Phosphotyrosine Protein Phosphatase, LMW-PTP, LMW-PTPase, Low Molecular Weight Cytosolic Acid Phosphatase, Red Cell Acid Phosphatase 1, PTPase, Adipocyte Acid Phosphatase) (MaxLight 750)

Sign In for Pricing
View Details
ACP1 (Low Molecular Weight Phosphotyrosine Protein Phosphatase, LMW-PTP, LMW-PTPase, Low Molecular Weight Cytosolic Acid Phosphatase, Red Cell Acid Phosphatase 1, PTPase, Adipocyte Acid Phosphatase) (MaxLight 750)
MBS6231407-02 5x 0.1 mL

ACP1 (Low Molecular Weight Phosphotyrosine Protein Phosphatase, LMW-PTP, LMW-PTPase, Low Molecular Weight Cytosolic Acid Phosphatase, Red Cell Acid Phosphatase 1, PTPase, Adipocyte Acid Phosphatase) (MaxLight 750)

Sign In for Pricing
View Details
Disintegrin and metalloproteinase domain-containing protein 12
AP79762-01 50 µg

Disintegrin and metalloproteinase domain-containing protein 12

Sign In for Pricing
View Details
Disintegrin and metalloproteinase domain-containing protein 12
AP79762-02 100 µg

Disintegrin and metalloproteinase domain-containing protein 12

Sign In for Pricing
View Details
Disintegrin and metalloproteinase domain-containing protein 12
AP79762-03 1 mg

Disintegrin and metalloproteinase domain-containing protein 12

Sign In for Pricing
View Details