Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF101 Rabbit Polyclonal Antibody (FITC)

ZNF101 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HZF12

UniProt

Q8IZC7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF101

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EWALLSPSQKNLYRDVTLETFRNLASVGIQWKDQDIENLYQNLGIKLRSL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_149981

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Receptor Interacting Serine Threonine Kinase 2 (RIPK2) Antibody Pair Kit (with Standard)
MBS2100879-01 5x 96 Tests

Mouse Receptor Interacting Serine Threonine Kinase 2 (RIPK2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Receptor Interacting Serine Threonine Kinase 2 (RIPK2) Antibody Pair Kit (with Standard)
MBS2100879-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Mouse Receptor Interacting Serine Threonine Kinase 2 (RIPK2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Receptor Interacting Serine Threonine Kinase 2 (RIPK2) Antibody Pair Kit (with Standard)
MBS2100879-03 10x 96 Tests

Mouse Receptor Interacting Serine Threonine Kinase 2 (RIPK2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Receptor Interacting Serine Threonine Kinase 2 (RIPK2) Antibody Pair Kit (with Standard)
MBS2100879-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Mouse Receptor Interacting Serine Threonine Kinase 2 (RIPK2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Monoclonal SUMO1 Antibody (SUMO1/1188) [HRP]
NBP2-47697H 0.1 mL

Mouse Monoclonal SUMO1 Antibody (SUMO1/1188) [HRP]

Sign In for Pricing
View Details
EIF2G (EIF2S3) (NM_001415) Human Over-expression Lysate
LY419953 100 µg

EIF2G (EIF2S3) (NM_001415) Human Over-expression Lysate

Sign In for Pricing
View Details