Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF670 Rabbit Polyclonal Antibody (FITC)

ZNF670 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q9BS34

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF670

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EDQNIQDDFKNPGRNLSSHVVERLFEIKEGSQYGETFSQDSNLNLNKKVS

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_149990

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADCY1 (Adenylate Cyclase 1, Brain) BioAssayTM ELISA Kit (Porcine) discontinued
353709 96 Tests

ADCY1 (Adenylate Cyclase 1, Brain) BioAssayTM ELISA Kit (Porcine) discontinued

Sign In for Pricing
View Details
SPATA1 ORF Vector (Human) (pORF)
ORF014564 1.0 µg DNA

SPATA1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
CHD4 (ATP-dependent Helicase CHD4, CHD-4, CHD4, Chromodomain Helicase DNA Binding Protein 4, Chromodomain-Helicase-DNA-Binding Protein 4, DKFZp686E06161, Mi-2 Autoantigen 218kD Protein, Mi-2b, Mi2-beta) (FITC) discontinued
253998 50 µL

CHD4 (ATP-dependent Helicase CHD4, CHD-4, CHD4, Chromodomain Helicase DNA Binding Protein 4, Chromodomain-Helicase-DNA-Binding Protein 4, DKFZp686E06161, Mi-2 Autoantigen 218kD Protein, Mi-2b, Mi2-beta) (FITC) discontinued

Sign In for Pricing
View Details
HIV Antibody [1946]
35-545 0.1 mg

HIV Antibody [1946]

Sign In for Pricing
View Details
Rabbit Monoclonal SARS-CoV-2 Nucleocapsid Antibody (001) [FITC]
NBP2-90988F 0.1 mL

Rabbit Monoclonal SARS-CoV-2 Nucleocapsid Antibody (001) [FITC]

Sign In for Pricing
View Details
Rabbit Polyclonal Galanin R2/GALR2 Antibody
NBP1-91921 0.1 mL

Rabbit Polyclonal Galanin R2/GALR2 Antibody

Sign In for Pricing
View Details