Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF670 Rabbit Polyclonal Antibody (HRP)

ZNF670 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9BS34

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF670

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EDQNIQDDFKNPGRNLSSHVVERLFEIKEGSQYGETFSQDSNLNLNKKVS

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_149990

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Quick Step Canine Lipid hydroperpxide LPO ELISA Kit
QS0180Ca-01 48 Tests

Quick Step Canine Lipid hydroperpxide LPO ELISA Kit

Sign In for Pricing
View Details
Quick Step Canine Lipid hydroperpxide LPO ELISA Kit
QS0180Ca-02 96 Tests

Quick Step Canine Lipid hydroperpxide LPO ELISA Kit

Sign In for Pricing
View Details
Defb6 Mouse shRNA Plasmid (Locus ID 116746)
TR519612 1 Kit

Defb6 Mouse shRNA Plasmid (Locus ID 116746)

Sign In for Pricing
View Details
ZXDA Rabbit Polyclonal Antibody
TA343664 100 µL

ZXDA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human RASSF4 Protein
E30P70436A 50 µg

Recombinant Human RASSF4 Protein

Sign In for Pricing
View Details
Bet1 (16G6) Alexa Fluor® 647
sc-58247 AF647 200 µg/mL

Bet1 (16G6) Alexa Fluor® 647

Sign In for Pricing
View Details