Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF160 Rabbit Polyclonal Antibody (HRP)

ZNF160 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

F11, HZF5, KR18, HKr18

UniProt

Q9HCG1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZN160

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KVFTQNSHLANHQRTHTGEKPYRCNECGKAFSVRSSLTTHQAIHTGKKPY

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

89kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

XP_006723525

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PI 3 Kinase Class 3 (PIK3C3) Human Gene Knockout Kit (CRISPR)
KN205317 1 Kit

PI 3 Kinase Class 3 (PIK3C3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Caveolin 1 (CAV1) (1-104) Mouse Monoclonal Antibody [Clone ID: AT4C1]
AM09383PU-S 50 µL

Caveolin 1 (CAV1) (1-104) Mouse Monoclonal Antibody [Clone ID: AT4C1]

Sign In for Pricing
View Details
TM6SF2 (NM_001001524) Human Over-expression Lysate
LY424371 100 µg

TM6SF2 (NM_001001524) Human Over-expression Lysate

Sign In for Pricing
View Details
Human HJURP activation kit by CRISPRa
GA110732 1 Kit

Human HJURP activation kit by CRISPRa

Sign In for Pricing
View Details
Human AHNAK2 activation kit by CRISPRa
GA114388 1 Kit

Human AHNAK2 activation kit by CRISPRa

Sign In for Pricing
View Details
Ttc13 Mouse Gene Knockout Kit (CRISPR)
KN518394 1 Kit

Ttc13 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details