Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC16 Rabbit Polyclonal Antibody (HRP)

CCDC16 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OMCG1, CCDC16

UniProt

Q96NB3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CCDC16

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ENTAEALPEGFFDDPEVDARVRKVDAPKDQMDKEWDEFQKAMRQVNTISE

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_443089

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2C, CT (Ubiquitin-conjugating Enzyme E2 C, Ubiquitin-protein Ligase C, Ubiquitin Carrier Protein C, UbcH10) (FITC)
MBS6504576-01 0.2 mL

UBE2C, CT (Ubiquitin-conjugating Enzyme E2 C, Ubiquitin-protein Ligase C, Ubiquitin Carrier Protein C, UbcH10) (FITC)

Sign In for Pricing
View Details
UBE2C, CT (Ubiquitin-conjugating Enzyme E2 C, Ubiquitin-protein Ligase C, Ubiquitin Carrier Protein C, UbcH10) (FITC)
MBS6504576-02 5x 0.2 mL

UBE2C, CT (Ubiquitin-conjugating Enzyme E2 C, Ubiquitin-protein Ligase C, Ubiquitin Carrier Protein C, UbcH10) (FITC)

Sign In for Pricing
View Details
RORB, CT (RORB, NR1F2, RZRB, Nuclear receptor ROR-beta, Nuclear receptor RZR-beta, Nuclear receptor subfamily 1 group F member 2, Retinoid-related orphan receptor-beta) (MaxLight 550) discontinued
041168-ML550 100 µL

RORB, CT (RORB, NR1F2, RZRB, Nuclear receptor ROR-beta, Nuclear receptor RZR-beta, Nuclear receptor subfamily 1 group F member 2, Retinoid-related orphan receptor-beta) (MaxLight 550) discontinued

Sign In for Pricing
View Details
IL18BP (ILBP 18, ILBP-18, IL18 BP, Interleukin 18 Binding Protein) (MaxLight 405)
MBS6452559-01 0.1 mL

IL18BP (ILBP 18, ILBP-18, IL18 BP, Interleukin 18 Binding Protein) (MaxLight 405)

Sign In for Pricing
View Details
IL18BP (ILBP 18, ILBP-18, IL18 BP, Interleukin 18 Binding Protein) (MaxLight 405)
MBS6452559-02 5x 0.1 mL

IL18BP (ILBP 18, ILBP-18, IL18 BP, Interleukin 18 Binding Protein) (MaxLight 405)

Sign In for Pricing
View Details
Human Complement Component 3 ELISA Kit
MBS732379-01 48 Strip Well (Competitive)

Human Complement Component 3 ELISA Kit

Sign In for Pricing
View Details