Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF300 Rabbit Polyclonal Antibody (FITC)

ZNF300 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DKFZp686B24204

UniProt

Q96RE9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF300

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DISNWIYPDEYQADGRQDRKSNLHNSQSCILGTVSFHHKILKGVTRDGSL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_443092

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine beta-muricholic acid ELISA kit
GTR10419799 96 Well

Bovine beta-muricholic acid ELISA kit

Sign In for Pricing
View Details
ROR1, soluble
S01-048 100 µg

ROR1, soluble

Sign In for Pricing
View Details
Recombinant Yersinia Enterocolitica recO Protein (aa 1-241) (strain 8081)
VAng-Wyb1737-50gEcoli 50 µg (E. coli)

Recombinant Yersinia Enterocolitica recO Protein (aa 1-241) (strain 8081)

Sign In for Pricing
View Details
CD8 (C8/144B), CF488A conjugate, 0.1mg/mL
BNC880749-500 1x 500 µL

CD8 (C8/144B), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MyD88 (h) : 293 Lysate
sc-111351 100 µg - 200 µL

MyD88 (h) : 293 Lysate

Sign In for Pricing
View Details
C/EBP-beta, phosphorylated (T235/188) (CCAAT/Enhancer-Binding Protein beta, C/EBP beta, C/EBPbeta, C/EBP beta, Liver Activator Protein, LAP, Liver-enriched Inhibitory Protein, LIP, Nuclear Factor NF-IL6, Transcription Factor 5, TCF-5, CEBPB, TCF5, ORF Names: PP9092) discontinued
221208-01 50 µL

C/EBP-beta, phosphorylated (T235/188) (CCAAT/Enhancer-Binding Protein beta, C/EBP beta, C/EBPbeta, C/EBP beta, Liver Activator Protein, LAP, Liver-enriched Inhibitory Protein, LIP, Nuclear Factor NF-IL6, Transcription Factor 5, TCF-5, CEBPB, TCF5, ORF Names: PP9092) discontinued

Sign In for Pricing
View Details