Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTCFL Rabbit Polyclonal Antibody (FITC)

CTCFL Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CT27, BORIS, CTCF-T, HMGB1L1, dJ579F20.2

UniProt

Q8NI51

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CTCFL

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RSDEIVLTVSNSNVEEQEDQPTAGQADAEKAKSTKNQRKTKGAKGTFHCD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_542185

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1738 3'UTR Luciferase Stable Cell Line
TU214974 1.0 mL

Olr1738 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ABCC1 (ATP-binding Cassette Sub-Family C Member 1, MRP, ABCC, GS-X, MRP1, ABC29) discontinued
209320-01 20 µL

ABCC1 (ATP-binding Cassette Sub-Family C Member 1, MRP, ABCC, GS-X, MRP1, ABC29) discontinued

Sign In for Pricing
View Details
ABCC1 (ATP-binding Cassette Sub-Family C Member 1, MRP, ABCC, GS-X, MRP1, ABC29) discontinued
209320-02 100 µL

ABCC1 (ATP-binding Cassette Sub-Family C Member 1, MRP, ABCC, GS-X, MRP1, ABC29) discontinued

Sign In for Pricing
View Details
HSF4 (Heat Shock Factor Protein 4, HSF 4, hHSF4, Heat Shock Transcription Factor 4, HSTF 4) APC
MBS6381772-01 0.1 mL

HSF4 (Heat Shock Factor Protein 4, HSF 4, hHSF4, Heat Shock Transcription Factor 4, HSTF 4) APC

Sign In for Pricing
View Details
HSF4 (Heat Shock Factor Protein 4, HSF 4, hHSF4, Heat Shock Transcription Factor 4, HSTF 4) APC
MBS6381772-02 5x 0.1 mL

HSF4 (Heat Shock Factor Protein 4, HSF 4, hHSF4, Heat Shock Transcription Factor 4, HSTF 4) APC

Sign In for Pricing
View Details
MSI5 Antibody
orb792214 2 mg

MSI5 Antibody

Sign In for Pricing
View Details