Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF551 Rabbit Polyclonal Antibody (HRP)

ZNF551 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q7Z340

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF551

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FVTGCRFHVLNYFTCGEAFPAPTDLLQHEATPSGEEPHSSSSKHIQAFFN

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

IHC, WB

NCBI Accession Number

BAC03625

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Klhl4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6161406 1.0 µg DNA

Klhl4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
TAS2R5 Polyclonal Antibody, HRP Conjugated
bs-11614R-HRP 100 µL

TAS2R5 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
ARFRP1 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-12514R-BF405 100 µL

ARFRP1 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
ARMCX3, CT (ARMCX3, ALEX3, Armadillo repeat-containing X-linked protein 3, ARM protein lost in epithelial cancers on chromosome X 3) (AP) discontinued
032090-AP 200 µL

ARMCX3, CT (ARMCX3, ALEX3, Armadillo repeat-containing X-linked protein 3, ARM protein lost in epithelial cancers on chromosome X 3) (AP) discontinued

Sign In for Pricing
View Details
Camel Neuron Derived Orphan Receptor 1 ELISA Kit
MBS089602-01 48 Well

Camel Neuron Derived Orphan Receptor 1 ELISA Kit

Sign In for Pricing
View Details
Camel Neuron Derived Orphan Receptor 1 ELISA Kit
MBS089602-02 96 Well

Camel Neuron Derived Orphan Receptor 1 ELISA Kit

Sign In for Pricing
View Details