Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF551 Rabbit Polyclonal Antibody (HRP)

ZNF551 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q7Z340

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF551

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FVTGCRFHVLNYFTCGEAFPAPTDLLQHEATPSGEEPHSSSSKHIQAFFN

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

IHC, WB

NCBI Accession Number

BAC03625

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Fc Fragment Of IgG Receptor Transporter Alpha (FcgRT)
TRV-0060299-01 20 µL

Monoclonal Antibody to Fc Fragment Of IgG Receptor Transporter Alpha (FcgRT)

Sign In for Pricing
View Details
Monoclonal Antibody to Fc Fragment Of IgG Receptor Transporter Alpha (FcgRT)
TRV-0060299-02 100 µL

Monoclonal Antibody to Fc Fragment Of IgG Receptor Transporter Alpha (FcgRT)

Sign In for Pricing
View Details
Monoclonal Antibody to Fc Fragment Of IgG Receptor Transporter Alpha (FcgRT)
TRV-0060299-03 200 µL

Monoclonal Antibody to Fc Fragment Of IgG Receptor Transporter Alpha (FcgRT)

Sign In for Pricing
View Details
Monoclonal Antibody to Fc Fragment Of IgG Receptor Transporter Alpha (FcgRT)
TRV-0060299-04 1 mL

Monoclonal Antibody to Fc Fragment Of IgG Receptor Transporter Alpha (FcgRT)

Sign In for Pricing
View Details
THNSL1 Lentiviral Activation Particles (h)
sc-416624-LAC 200 µL

THNSL1 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Mib1, NT (E3 Ubiquitin-protein Ligase MIB1, Mind Bomb Homolog 1, DAPK-interacting Protein 1, DIP-1, Zinc Finger ZZ Type With Ankyrin Repeat Domain Protein 2, MIB1, DIP1, KIAA1323, ZZANK2) (MaxLight 490) discontinued
M3753-01-ML490 100 µL

Mib1, NT (E3 Ubiquitin-protein Ligase MIB1, Mind Bomb Homolog 1, DAPK-interacting Protein 1, DIP-1, Zinc Finger ZZ Type With Ankyrin Repeat Domain Protein 2, MIB1, DIP1, KIAA1323, ZZANK2) (MaxLight 490) discontinued

Sign In for Pricing
View Details