Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SP140L Rabbit Polyclonal Antibody (Biotin)

SP140L Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q9H930

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LOC93349

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TVDFQAPLLPVTCGGVKGILHKEKLEQGTLAKCIQTEDGKWFTPMEFEIK

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_612411

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC41A2, NT (SLC41A2, Solute carrier family 41 member 2) (Azide free) (HRP) discontinued
041944-HRP 200 µL

SLC41A2, NT (SLC41A2, Solute carrier family 41 member 2) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
DHODH Lentiviral Activation Particles (m2)
sc-425293-LAC-2 200 µL

DHODH Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
C1INH CRISPR Activation Plasmid (h2)
sc-403065-ACT-2 20 µg

C1INH CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Recombinant Human uPAR (C-His)
BP121-10ug 10 µg

Recombinant Human uPAR (C-His)

Sign In for Pricing
View Details
Lentiviral mouse Amy1 shRNA (UAS) - Lentiviral mouseAmy1 shRNA (UAS, GFP) (25)
GTR15211940 1 Vial

Lentiviral mouse Amy1 shRNA (UAS) - Lentiviral mouseAmy1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Ephb3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6502207 1.0 µg DNA

Ephb3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details